FULLSTACKROOFING
Call

Roofing Guides

Plain-language guides to help homeowners understand roof replacement, repairs, hail damage, insurance claims, and more.

Ready to discuss a project? Compare our roof inspection and roof replacement services.

Browse by topic

Emergency Leaks and Repairs

What to do when water is entering now, a roof component has failed, or a repair needs to be scoped safely.

repairleakemergencymissing-shingledamage

Storm, Hail and Insurance

Document wind and hail conditions, understand claim evidence, and decide what needs attention after a storm.

stormhailinsurancewindclaimappraisal

Repair vs. Replacement

Compare service life, hidden conditions, roof age, and scope quality before choosing a repair or replacement.

replacementrepairreroofroofing-materials

Costs, Financing and Estimates

Plan a realistic Utah roofing budget and learn which details change the price of the work.

costpricefinancingcalculatorestimate

Shingles, Metal and Roof Systems

Understand common residential materials, low-slope systems, installation details, and long-term tradeoffs.

shinglemetalmaterialroofing-typesinstallationflat-roof

Snow, Ventilation and Maintenance

Prepare for Utah snow, drainage, ventilation, seasonal wear, and the maintenance that extends roof life.

snowventilationmaintenanceslopedrainagegutter

Contractors, Permits and Warranties

Vet a contractor, compare bids, understand permits, and keep warranty decisions grounded in written scope.

contractorpermitwarrantyreviewcertifiedappraisal

Commercial and Property Management

Resources for commercial owners, facility teams, HOAs, and property managers planning low-slope work.

commercialindustrialflat-roofproperty-managementmulti-family

Utah City Resources

City-specific roofing, climate, permit, and service-area context for Utah homeowners.

salt-lakesandyjordanprovoogdenorem
Roof inspection Utah guide
Roof replacement Utah guide
Roof repair Utah guide
Completed Utah roof aerial

How Much Does a Roof Replacement Cost?

Understand roof replacement costs for 2026—material options, labor, size factors, and how to compare quotes without getting overcharged.

Read guide →

Roof Repair vs. Replacement: How to Decide

Should you repair or replace your roof? Learn the key factors—age, damage extent, repair cost ratio, and material condition—to make the right call.

Read guide →

How to Identify Roof Hail Damage: What Homeowners Should Know

Learn how roofers identify functional hail damage vs. cosmetic damage, why ground-level inspection misses most of it, and what your insurance adjuster looks for.

Read guide →

How to Compare Roofing Bids Without Getting Overcharged

Learn how to compare roofing quotes accurately—what scope details to require, how to spot low-bid traps, and what questions to ask before signing.

Read guide →

What to Expect During a Professional Roof Inspection

Learn what a professional roof inspection covers, how long it takes, and what a good inspection report should include before you hire anyone.

Read guide →

Ice Dams on Roofs: Causes, Prevention, and Repair

Learn why ice dams form, what damage they cause, and the lasting solution—insulation and ventilation—that prevents them from coming back.

Read guide →

Metal Roofing: Types, Costs, and Benefits

Compare standing seam vs. exposed fastener metal roofing, understand installed costs, and learn when metal is the right long-term choice for your home.

Read guide →

Roof Ventilation: How It Works and Why It Matters

Understand balanced attic ventilation—intake vs. exhaust, common mistakes, and how proper airflow extends roof life and reduces energy costs.

Read guide →

Should You Replace Your Roof Before Installing Solar?

Learn why roof condition matters before solar installation, what the cost of removing and reinstalling panels adds to a late replacement, and how to sequence the decision.

Read guide →

Filing a Roof Insurance Claim: What Homeowners Need to Know

Learn the correct sequence for filing a roof insurance claim after storm damage—documentation, adjuster visits, contractor coordination, and common mistakes.

Read guide →

Roof Replacement Cost in Utah

Understand Utah roof replacement cost drivers: roof size, pitch, tear-off, decking, ventilation, snow protection, UV exposure, and material choice.

Read guide →

Roof Repair in Salt Lake City

Salt Lake City roof repair guide covering leaks, flashing failures, storm damage, ice dams, swamp cooler penetrations, and when to replace.

Read guide →

Hail Damage Roof Inspection in Utah

Utah hail damage roof inspection guide: functional shingle damage, metal dents, photo documentation, insurance timing, and adjuster preparation.

Read guide →

Ice Dam Roof Repair in Utah

Utah ice dam roof repair guide covering eave leaks, snowmelt backup, ventilation, insulation, ice-and-water shield, and lasting prevention.

Read guide →

Swamp Cooler Removal From a Roof in Utah

Utah roof swamp cooler removal guide: deck patching, curb removal, electrical/HVAC coordination, shingles, flashing, and leak prevention.

Read guide →

Metal Roofing Utah Cost

Utah metal roofing cost guide comparing standing seam, exposed fastener panels, snow retention, underlayment, labor, and long-term value.

Read guide →

Roofing Insurance Claim Help in Utah

Utah roofing insurance claim guide: storm documentation, contractor inspections, adjuster meetings, supplements, deductibles, and claim mistakes.

Read guide →

Best Roof Type for Utah Snow and UV

Compare the best Utah roof types for snow, UV, hail, ice dams, ventilation, solar, and long-term maintenance.

Read guide →